DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31220

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:106/263 - (40%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NRVINGEDVQLGEAKYQISLQGMYGGH-----------ICGGCIIDERHVLTAAHCVYGYNPTYL 101
            ||||.|.:..|.|..:...|  :|...           .|||.:|:.|:||||||||........
  Fly   102 NRVIGGTEPNLNEYPWLAML--LYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQ 164

  Fly   102 RVITG--TVEYEKPDAV--------------YFVEEHWIHCNYNSPDY--HNDIALIRLNDTIKF 148
            ||..|  |..: .||.:              ..||....|.:|:..:|  .|||||:||.:.:::
  Fly   165 RVRLGEHTTSH-NPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRY 228

  Fly   149 NEYTQP---AELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNG 210
            .....|   .:.|.:.:.  .::.:.|||.|.::.....:|:.|.:.......|.|...:.....
  Fly   229 TMAYYPICVLDYPRSLMK--FKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGP 291

  Fly   211 PCHICTLTTGGQGACHGDSGGPLTHNG--------VLYGLVNWGYPC-ALGVPDSHANVYYYLEW 266
            ...||......:|.|.||||.||....        .|.|:.::|.|| .:|.|........:.:|
  Fly   292 RFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKW 356

  Fly   267 IRS 269
            ||:
  Fly   357 IRA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 66/258 (26%)
Tryp_SPc 50..269 CDD:238113 67/259 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 66/258 (26%)
Tryp_SPc 104..360 CDD:238113 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.