DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG33159

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:230 Identity:64/230 - (27%)
Similarity:106/230 - (46%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGT--VE 109
            :.|::.|::..:.|..|.:.|: ..|..||||.:|..|.||:|||||||..|....|..|.  ::
  Fly    23 KTRIVGGKETTISEVPYLVYLR-QNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLD 86

  Fly   110 YEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA-----PVANGTQLL 169
            .|.|.....|..| ...:|::.::..|:||::|.:.:...    |.::.|.     |........
  Fly    87 QEAPVVRNVVMFH-TSPSYSATNFDMDVALLQLQEVVVLT----PGKVATISPCRNPPEGNAYAR 146

  Fly   170 LTGWGSTELWGDTPDILQKAYLTHVV--------YSTCQEIMNNDPSNGPCHICTLTTGGQGACH 226
            ::|||.|......|....:..:..|:        ||...::.::       .:|....|.:.:|.
  Fly   147 ISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDS-------MLCAAVRGLRDSCS 204

  Fly   227 GDSGGPLTHNGVLYGLVNWGYPCAL-GVPDSHANV 260
            |||||||.:.|.:.|:|:||:.||. ..|..:.||
  Fly   205 GDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 64/228 (28%)
Tryp_SPc 50..269 CDD:238113 63/227 (28%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 64/228 (28%)
Tryp_SPc 26..251 CDD:238113 63/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.