DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31681

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:249 Identity:76/249 - (30%)
Similarity:112/249 - (44%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE 111
            :.|::.|..:.:....:|:|:|. ...|.|||.|..:|.:||||||:.....|.|.|..|:..:.
  Fly    26 EERIVGGSYIPIEYVPWQVSVQN-NSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWS 89

  Fly   112 KPDAVYFVEEHWIHCNYNSPDYHN--DIAL------IRLNDTIKFNEYTQPAELPTA---PVANG 165
            |...|..|.:...|..| .|..:|  |||:      :||..|:|        ::|.|   ||| |
  Fly    90 KGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRLGGTVK--------KIPLAEQTPVA-G 144

  Fly   166 TQLLLTGWGSTE-----LWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCH----ICTLTTGG 221
            |.:|.:|||.|.     ||    .|||..::..:..:.|.:...        |    |..:...|
  Fly   145 TIVLTSGWGYTRENSSFLW----PILQGVHVAILNRTDCLKAYK--------HVNITIDMICADG 197

  Fly   222 Q--GACHGDSGGPL---THNG--VLYGLVNWGYPCALGVPDSHANVYYYLEWIR 268
            |  ..|.|||||||   |..|  .|.|:|:||..|... |..:.::.::..||:
  Fly   198 QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-PGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 74/244 (30%)
Tryp_SPc 50..269 CDD:238113 75/246 (30%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 74/244 (30%)
Tryp_SPc 29..250 CDD:238113 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.