DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31205

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:290 Identity:64/290 - (22%)
Similarity:114/290 - (39%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDV--QLGEAKYQISLQGM 70
            ::|..||..|...|  .::.|.:.::.        |: |..:..|.:::  :..|..:.:.:.|:
  Fly     5 KLLTFLLTITTLHP--TIQAASVGQEC--------GI-FNEKQYNSDNIIAEPTEHPWVVRIVGV 58

  Fly    71 Y--GGH--ICGGCIIDERHVLTAAHCV--------YGYNPTYLRVITGTVEYEKPDAVYFVEEHW 123
            .  |.:  :|.|.:||.|.|:||||||        ||       |:.|..:....:.|..|.   
  Fly    59 TKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYG-------VVFGDSDSSNINLVSAVT--- 113

  Fly   124 IHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPT------APVANGTQLLLTGWGSTELWGDT 182
            :|.:|:...:.||:|:|.|...:.|::..||..||:      ....:.::|::.|     |.|.:
  Fly   114 VHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG-----LEGPS 173

  Fly   183 PDILQ----------KAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNG 237
            .|...          |...|.:....|.|.....|....|.....:.....|....||.|...: 
  Fly   174 FDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEASGTPRQFH- 237

  Fly   238 VLYGLVNWGYPCALGVPDSHANVYYYLEWI 267
             |.|:...|:..:......:.|:..:|:||
  Fly   238 -LLGIAVAGFFSSDLDHQGYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 54/247 (22%)
Tryp_SPc 50..269 CDD:238113 56/248 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.