DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG32808

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:231 Identity:76/231 - (32%)
Similarity:107/231 - (46%) Gaps:16/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RVINGEDVQLGEAKYQISL-QGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEK 112
            :::||.....||..:.:|| :...|.|.||..:::...||||||||.|.:|..|.:..|:....:
  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93

  Fly   113 PDA-VYFVEEHWIHCNYNSPD-YHNDIALIRLNDTIKFNEYTQPAELP----TAPVANGTQLLLT 171
            ..: |..|...::|..|...| |.|||||::|..::..:::.||..||    ..|  .....:|.
  Fly    94 NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTP--GNASAVLA 156

  Fly   172 GWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICT-LTTGGQGACHGDSGGPLTH 235
            |||.....|.....|||..|.....:.|.|  .:........||. |..||:|.|.|||||||..
  Fly   157 GWGLNATGGVVQQHLQKVKLQVFSDTECSE--RHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLL 219

  Fly   236 NG--VLYGLVNWGY-PCAL-GVPDSHANVYYYLEWI 267
            .|  ...|:|:|.. |||. ..|.....|..|::||
  Fly   220 IGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 74/229 (32%)
Tryp_SPc 50..269 CDD:238113 76/230 (33%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/229 (32%)
Tryp_SPc 30..258 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.