DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and sphinx1

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:233 Identity:53/233 - (22%)
Similarity:84/233 - (36%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YGGHICGGCIIDERHVLTAAHCV-YGYNPTYLRVITGTVEYEKPDAVYFVEEHW----------- 123
            ||    .|.||..:.:||....: |.|...:|   .....|...|.:...:|::           
  Fly    55 YG----AGTIISNQWILTVKTVLKYSYIEVHL---ASRRSYRGFDIIRIYKENFRFHYDNDHVIA 112

  Fly   124 -IHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQ 187
             :.|.|...|...|...:...|| :|..|.            |...::.|:|:.:.....|:   
  Fly   113 LVKCPYQKFDRRMDRVRVPAYDT-RFERYV------------GNMTMVCGYGTEKRHAKLPE--- 161

  Fly   188 KAYLTHVVYSTC--QEIMNNDPSNGPC----------HICTLTTGGQGACHGDSGGPLT---HNG 237
                    :..|  .|:|||.    .|          .:||...|.:|.|.||.||.:.   .|.
  Fly   162 --------WMRCIEVEVMNNT----ECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNP 214

  Fly   238 VLYGLVNWGYP--CALGVPDSHANVYYYLEWIRSMISG 273
            ...|:: |..|  |::|.|..|..|..:::||: .:||
  Fly   215 TFIGII-WLMPENCSIGYPSVHIRVSDHIKWIK-RVSG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 49/225 (22%)
Tryp_SPc 50..269 CDD:238113 51/227 (22%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 49/225 (22%)
Tryp_SPc 26..248 CDD:304450 51/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.