DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Prtn3

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:243 Identity:79/243 - (32%)
Similarity:114/243 - (46%) Gaps:25/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVNFQ-----NRVINGEDVQLGEAKYQISLQ--GMYGGHICGGCIIDERHVLTAAHCVYGYNPTY 100
            ||.|.     ::::.|.:.:.....|..|||  ...|.|.|||.:|..|.|||||||:...:...
  Rat   186 GVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQL 250

  Fly   101 LRVITGTVEY--EKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP--TAP 161
            :.|:.|..:.  .:|:...|........|||..:..||:.|::||......:....|.||  ...
  Rat   251 VTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQS 315

  Fly   162 VANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLT-TGGQGAC 225
            ::.|||.|..|||.......||.:|.:..:| ||...|:|          .::|||. ....|.|
  Rat   316 LSQGTQCLAMGWGRLGTRAPTPRVLHELNVT-VVTFLCRE----------HNVCTLVPRRAAGIC 369

  Fly   226 HGDSGGPLTHNGVLYGLVNWGY-PCA-LGVPDSHANVYYYLEWIRSMI 271
            .|||||||..||:|:|:.::.. .|| |..||..|.|..|:.||.|::
  Rat   370 FGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 73/226 (32%)
Tryp_SPc 50..269 CDD:238113 75/227 (33%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.