DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Klk12

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:283 Identity:81/283 - (28%)
Similarity:124/283 - (43%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMY 71
            :::.::||.|       .|.|:|...:               ::.||.:.......:|:.|  .:
  Rat     1 MKLNILLLLC-------VVGLSQADRE---------------KIYNGVECVKNSQPWQVGL--FH 41

  Fly    72 GGHI-CGGCIIDERHVLTAAHCVYGYN-------------PTYLRVITGTVEYEKPDAVYFVEEH 122
            |.:: |||.::|.:.|||||||...|.             ...||:.|.::.:......|...||
  Rat    42 GKYLRCGGVLVDRKWVLTAAHCSGKYMVRLGEHSLSKLDLTEQLRLTTFSITHPSYHGAYQNHEH 106

  Fly   123 WIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGST-ELWGDTPDIL 186
                         |:.|:|||..|......:|..||::....|.:..::|||:| :.|...||.|
  Rat   107 -------------DLRLLRLNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRL 158

  Fly   187 QKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGY--PC 249
            |...|:.|...||:.:.....:..  .:|.....|:.||.|||||||...|||.|||:||.  ||
  Rat   159 QCLDLSIVSNETCRAVFPGRVTEN--MLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPC 221

  Fly   250 A-LGVPDSHANVYYYLEWIRSMI 271
            . .|:|..:..|..|.:|||.:|
  Rat   222 GQKGIPGVYTKVCKYTDWIRVVI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/235 (30%)
Tryp_SPc 50..269 CDD:238113 73/236 (31%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.