DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Elane

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:282 Identity:83/282 - (29%)
Similarity:121/282 - (42%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGG 73
            :|.:||.|    |..|                       :.::.|...|.....:.:||| ..||
  Rat    19 LLALLLVC----PALA-----------------------SEIVGGRPAQPHAWPFMVSLQ-RRGG 55

  Fly    74 HICGGCIIDERHVLTAAHCVYGYNPTYLRVITGT--VEYEKPDAVYFVEEHWIHCNYNSPDYHND 136
            |.||..:|....|::|||||.|.|...::|:.|.  :...:|....|..:......::.....||
  Rat    56 HFCGATLIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLND 120

  Fly   137 IALIRLNDTIKFNEYTQPAELPT--APVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTC 199
            |.:|:||.:...|...|.||||.  ..|.|.|..:..|||........|.:||:..:| ||.:.|
  Rat   121 IVIIQLNGSATINANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVT-VVTNLC 184

  Fly   200 QEIMNNDPSNGPCHICTLTTGGQ-GACHGDSGGPLTHNGVLYGL---VNWGYPCALG-VPDSHAN 259
            :..:|         :|||....| |.|.|||||||..|.::.|:   :..|  |..| .||:.|.
  Rat   185 RRRVN---------VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG--CGSGFYPDAFAP 238

  Fly   260 VYYYLEWIRSMISG----PCSN 277
            |..:.:||.|:|..    |.:|
  Rat   239 VAEFADWINSIIRSHDDRPLTN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/226 (31%)
Tryp_SPc 50..269 CDD:238113 73/227 (32%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 71/226 (31%)
Tryp_SPc 33..249 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.