DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Klk10

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:225 Identity:57/225 - (25%)
Similarity:93/225 - (41%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYH------ 134
            |.|.::|:..||||||| :...|...||        ..|.:...:...:. :.|||.:|      
  Rat    72 CAGVLVDQNWVLTAAHC-WRNKPLRARV--------GDDHLLLFQSEQLR-STNSPVFHPKYQPC 126

  Fly   135 -----------NDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTE----LWGDTPD 184
                       :|:.:::|:..:.......|.:||........:..::|||:|.    .:..:  
  Rat   127 SGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRS-- 189

  Fly   185 ILQKAYLTHVVYSTCQE-----IMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVN 244
             |..:.:|.:....|:.     |.||       .||......|.:|..||||||..:..|:|:::
  Rat   190 -LSCSRVTLLSQKQCETFYPGVITNN-------MICAGMDRDQDSCQSDSGGPLVCDNTLHGILS 246

  Fly   245 WG-YPC--ALGVPDSHANVYYYLEWIRSMI 271
            |. |||  |...|..:|.:..|..|||.:|
  Rat   247 WSIYPCGAATQYPAVYAKICNYTNWIRRVI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 53/219 (24%)
Tryp_SPc 50..269 CDD:238113 55/221 (25%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 53/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.