DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Prss29

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:246 Identity:75/246 - (30%)
Similarity:121/246 - (49%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VINGEDVQLGEAKYQISLQGMY------GGHICGGCIIDERHVLTAAHCVY--GYNPTYLRVITG 106
            ::.|.....|:..:|:||: :|      ..|||||.||..:.|||||||::  ..:|:..|:..|
  Rat    31 IVGGNSAPQGKWPWQVSLR-VYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLG 94

  Fly   107 TVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA--PVANGTQLL 169
            .|.....:.:..|....||.::......:|:||::|..:::.....:|.:|..|  .|.......
  Rat    95 QVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTKKDVCW 159

  Fly   170 LTGWGSTELWGDTPD--ILQKAYLTHVVYSTCQEIMNNDP--SNGPCH---------ICTLTTGG 221
            :|||||..:....|.  .||:..:..|..:.|:::..|..  ||   |         :|. .:.|
  Rat   160 VTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSN---HGQRLILQDMLCA-GSHG 220

  Fly   222 QGACHGDSGGPL----THNGVLYGLVNWGYPCAL-GVPDSHANVYYYLEWI 267
            :.:|:|||||||    |.:..|.|:|:|||.||| .:|..:|.|.::|.||
  Rat   221 RDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 73/244 (30%)
Tryp_SPc 50..269 CDD:238113 75/246 (30%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.