DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG18420

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:95/254 - (37%) Gaps:64/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKP 113
            |::||:......:.:...|.......||||.:|..|.||||||| :..|.|   ::....||.:.
  Fly    42 RIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHC-FIPNTT---IVVRLGEYNRK 102

  Fly   114 DAVYFVEEHWI-----HCNYNSPDYHNDIALIRLNDTIKFNEYTQPA----------ELPTAPVA 163
            ...| .|||.:     |..|:...:.|||||:||...:.:....:|.          .:.:..|.
  Fly   103 LKGY-REEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVL 166

  Fly   164 NGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTT--------- 219
            .|     ||||.||...|:                 .|:...|.|..|..:|...:         
  Fly   167 TG-----TGWGRTESMHDS-----------------SELRTLDISRQPSKMCAFGSVLSNQFCAG 209

  Fly   220 -GGQGACHGDSGGPLTHNGVLYGLVNWGYPCALGV---------PDSHANVYYYLEWIR 268
             .....|.||:|||:   |.:....|......:|:         |....:|..::|:||
  Fly   210 NWNSNLCIGDTGGPV---GAMVRYRNAFRFVQVGIAITNKRCQRPSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 61/251 (24%)
Tryp_SPc 50..269 CDD:238113 62/253 (25%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 61/251 (24%)
Tryp_SPc 43..267 CDD:238113 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.