DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG33462

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:309 Identity:73/309 - (23%)
Similarity:113/309 - (36%) Gaps:98/309 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGV--NFQNRVINGEDVQLGEAKYQISLQGMY 71
            |:.|.:.|..::.:...::. |.||.        |:  |...|.:|   .:|.:..:...|:...
  Fly     5 IIGIAVICCLWRRVQGFQML-LEEDC--------GIPHNISERSVN---AKLAQNPWMAYLETPK 57

  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEY-------------EKPDAVYFVEEHW 123
            |.| |.|.:|:...||||||||    |..|.:.....||             ::|...|.|:..:
  Fly    58 GFH-CSGTLINHLFVLTAAHCV----PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGF 117

  Fly   124 IHCNYNSPDYHNDIALIRLNDTIKF------------NEYTQPAELPTAPVANGTQLLLTGWGST 176
            .|..||:.|..|||.::||...:::            |.:.:|.:..|             |.:|
  Fly   118 RHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT-------------WFTT 169

  Fly   177 ELWGD-----TPDILQKAYLTHVVYSTCQEI----MNNDPSNGPCHICTLTTGGQGACHGDSGGP 232
            .:|.:     |..:|:...:......||.||    |..:      .||...|..| .|..|||.|
  Fly   170 TVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFE------QICAGNTLSQ-LCSTDSGAP 227

  Fly   233 ----LTHNGVLYGLVNWGYPCALGVPDSHANVYYYLEWIRSMISGPCSN 277
                :.|||                    ::.|..| .|.|.:.|.|.|
  Fly   228 QIRKMWHNG--------------------SDRYVQL-GIASRVKGQCQN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 60/255 (24%)
Tryp_SPc 50..269 CDD:238113 60/256 (23%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/254 (24%)
Tryp_SPc 48..269 CDD:214473 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.