DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Sp212

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:103/253 - (40%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VINGEDVQLGEAKYQISLQGMYGGHI------CGGCIIDERHVLTAAHCVYGYNPTYLRVITGTV 108
            ::.|.:...|:..:   |..:|...:      |.|.:|....|::|||||  :..|..||:.|..
  Fly   277 IVRGNEFPRGQYPW---LSAVYHKEVRALAFKCRGSLISSSIVISAAHCV--HRMTEDRVVVGLG 336

  Fly   109 EYEKPDAVYFVEEH----------WIHCNYNSPDYHN-DIALIRLNDTIKFNEYTQPAELPTAPV 162
            .|:..|   :.|:.          | |.:||:..|.: |||||.:...:.||:...|..:.|...
  Fly   337 RYDLDD---YGEDGAEMRNVMRLLW-HPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEA 397

  Fly   163 AN--GTQLLLTGWGSTELWGDT--PDILQKAYLTHVV-YSTCQEIMNNDPSNGPCHICTLTTGGQ 222
            :.  .|...:.|||..|....|  |.:::....:..| .||.:..|..:.|     :|.....|.
  Fly   398 SRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERS-----LCAGNRDGS 457

  Fly   223 GACHGDSGGPLT----HNGVLYGLVNWGYPCALGVPDSHANVYY-----YLEWIRSMI 271
            |.|.|||||.|.    ...:|.|:|:.|.....|....:..|.|     ::.||...|
  Fly   458 GPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 63/247 (26%)
Tryp_SPc 50..269 CDD:238113 65/249 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/250 (26%)
Tryp_SPc 277..511 CDD:214473 63/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.