DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30286

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:236 Identity:61/236 - (25%)
Similarity:101/236 - (42%) Gaps:53/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEK-------------PDAVYFVEEHW 123
            |..:|||.:::.|.:||||||:  .....|.|..|  |:..             |...:.::..:
  Fly    56 GELVCGGTLVNHRFILTAAHCI--REDENLTVRLG--EFNSLTSIDCNGSDCLPPSEDFEIDVAF 116

  Fly   124 IHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGT---------QLLLTGWGSTELW 179
            .|..|:..:..:||.|:||..::::..:.:|..|    :.|.|         :|:.||||.    
  Fly   117 RHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICL----ITNTTLQPKIERLHRLVATGWGR---- 173

  Fly   180 GDTPD-----ILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL-----T 234
              :|.     ||:...:|.|.:..|.:....|....  .||.....|. :|.||||||:     .
  Fly   174 --SPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRD--QICVSHESGV-SCSGDSGGPMGQAIRL 233

  Fly   235 HNGVLY---GLVNWGYPCALGVPDSHANVYYYLEWIRSMIS 272
            ...||:   |:|::|....|. |....||..:::||.:.:|
  Fly   234 DGRVLFVQVGIVSYGNAECLS-PSVFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 58/229 (25%)
Tryp_SPc 50..269 CDD:238113 60/231 (26%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 59/230 (26%)
Tryp_SPc 39..268 CDD:214473 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.