DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30187

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:114/254 - (44%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVNFQNRVINGEDVQLGEAKYQISLQGMYGGH-----ICGGCIIDERHVLTAAHCVYGYNPTYLR 102
            |:|...::..|.:     |.:|.|: .|...|     ||||.:|.:|.|||||||:  .:.....
  Fly    29 GINIALKITGGHN-----AAFQNSV-WMAAVHNRTHFICGGTLIHKRFVLTAAHCI--VDQDVQS 85

  Fly   103 VITGTVEYEKP----DAVYFVEEHWIHCNYN-SPDYHNDIALIRLNDTIKFNEYTQP-AELPTAP 161
            |..|......|    |.:..|    :|.::: ...|.|||.|::|:..:.||...:| ..:....
  Fly    86 VSLGAYNKSDPADRKDVITAV----VHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKS 146

  Fly   162 VANGTQLLLT----GWGSTELWGD-TPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGG 221
            :||..:.:.|    |||:  |.|: |.||||...|.|:....|...::..||..  .||.....|
  Fly   147 MANHMRNMRTFKAFGWGT--LRGNKTSDILQTIILNHLDREECYMELSVYPSEK--QICAGVPSG 207

  Fly   222 QGACHGDSGGPLTHN---------GVLYGLVNWGYPCALGVPDSHANVYYYLEWIRSMI 271
            . .|.||||||||::         .|.:|:::.|.....| ...:.::..:.:||:..|
  Fly   208 D-TCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDG-QGVYTDLMSFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/242 (28%)
Tryp_SPc 50..269 CDD:238113 70/243 (29%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 68/242 (28%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.