DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30098

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:250 Identity:71/250 - (28%)
Similarity:103/250 - (41%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEY 110
            |:.|||.|::.:.......:.....:.   |||.:|..|.|||||||....:..::|:    .||
  Fly    33 FRIRVIGGQNARRTPWMAYLIRDNRFA---CGGSLIAYRFVLTAAHCTKINDNLFVRL----GEY 90

  Fly   111 EKPDAV------YFVEEHWIHCNYNSPDYHN-DIALIRLNDTIKFNEYTQP----AELPTAPVAN 164
            :.....      |.|...:.|.||  .|:.| |||:::|:..:.::.|.:|    .......:||
  Fly    91 DSSRTTDGQTRSYRVVSIYRHKNY--IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLAN 153

  Fly   165 GTQ-LLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGD 228
            ..| ..|||||....:...|..||:..|..|....|     ..||...|  |....  |.||.||
  Fly   154 SIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-----GVPSLSIC--CWNPV--QYACFGD 209

  Fly   229 SGGPLTHNGVLYGLVNWGYPCALGVPDSHANVYYYLEWIRSMISGPCSNCHCYAS 283
            |||||.      .||.:|          |..:|... .:.:.::|   ||..|:|
  Fly   210 SGGPLG------SLVKYG----------HKTIYVQF-GVTNSVTG---NCDGYSS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 65/229 (28%)
Tryp_SPc 50..269 CDD:238113 64/230 (28%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 69/246 (28%)
Tryp_SPc 37..258 CDD:238113 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.