DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30091

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:297 Identity:82/297 - (27%)
Similarity:122/297 - (41%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQ--NRVINGEDVQLGEAKYQ-ISLQGMYG 72
            |:|.|........:.||  |.||.        ||..|  .:::.|.|.  ||.|.. ::|.....
  Fly     6 VVLFAWMLTAGRGSARL--LDEDC--------GVPMQLIPKIVGGVDA--GELKNPWMALIKTND 58

  Fly    73 GHICGGCIIDERHVLTAAH-------CVYGYNPTYLRVITG------TVEYEKPDAVYFVEEHWI 124
            ..||||.:|..:.||||||       |:..|  |.|.|..|      |.|:..|..:|.||..:|
  Fly    59 EFICGGSVITNKFVLTAAHCMCTDEECIVKY--TQLTVTLGVYHLLATGEHNHPHEIYNVERVYI 121

  Fly   125 HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANG-----TQLL----LTGWGSTELWG 180
            |.::...:|.|||||:||..:|.:    :|...|...:.|.     |.|:    ..|||.|.. |
  Fly   122 HDSFAIQNYRNDIALLRLQKSIVY----KPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGN-G 181

  Fly   181 DTPDILQKAYLTHVVYSTCQEIM---NNDPSNGPCHICTLTTGGQGACHGDSGGPL----THNGV 238
            ...:.||...:..:....|:...   .:.|.     .|..|..|:..|..||||||    ..:|:
  Fly   182 KMSNNLQMVKIYRIDRKMCEAAFWYTFDYPM-----FCAGTAVGRDTCKRDSGGPLYIHMLFDGI 241

  Fly   239 ----LYGLVNWGYPCALGVPDSHANVYYYLEWIRSMI 271
                ..|:|:.|.....|. ..:.:|..::::|..::
  Fly   242 KRATQLGIVSTGTEDCRGF-GMYTDVMGHIDFIERIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/251 (28%)
Tryp_SPc 50..269 CDD:238113 71/252 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 70/251 (28%)
Tryp_SPc 37..276 CDD:238113 71/253 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.