DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30087

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:283 Identity:85/283 - (30%)
Similarity:131/283 - (46%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ISAVRLAQLSEDQLEWISKAEGVNFQN----RVINGEDVQLGEAKYQISLQGMYGGHICGGCIID 82
            |..:|..::.:.|  :::...||.:::    ||:||::..:..|.:.:.:......| |||.|::
  Fly    12 ICLIRQQRIVDAQ--FLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTH-CGGSILN 73

  Fly    83 ERHVLTAAHCVYGYNPTYLRVITGTVEYE---KPDA----------VYFVEEHWIHCNYNSPDYH 134
            .|::|||||||:   |. ||:..|  |:.   .||.          .|.:.:...|..||:.::.
  Fly    74 SRYILTAAHCVF---PN-LRLRLG--EHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHV 132

  Fly   135 NDIALIRLNDTIKFNEYTQPAEL----PTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVV 195
            |||||::||.:|.||.:.||..:    .:||.....|..  |||.|:..| .|.:||.|.|....
  Fly   133 NDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTF--GWGETKKNG-FPHLLQTAELRAYD 194

  Fly   196 YSTCQE----IMNNDPSNGPCHICTLTTGG---QGACHGDSGGPLT----HNGV----LYGLVNW 245
            .:.|..    .||.:      .||    .|   :..|.|||||||.    .:||    ..|:|::
  Fly   195 AAYCSRSFHAYMNGN------QIC----AGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSY 249

  Fly   246 GYPCALGVPDSHANVYYYLEWIR 268
            | |.....|..:..|..|:.|||
  Fly   250 G-PTDCQSPGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 77/249 (31%)
Tryp_SPc 50..269 CDD:238113 79/251 (31%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/249 (31%)
Tryp_SPc 42..272 CDD:238113 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.