DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30083

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:211 Identity:61/211 - (28%)
Similarity:97/211 - (45%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYF-VEEHWIHCNYNSPDYHNDIA 138
            :|||.:|.::.||:||||:  .....|.|..|    |...:.|| |.:.:.:..:.:..|.|||.
  Fly    63 VCGGTLIHKQFVLSAAHCI--KRDQILAVRLG----EHSSSRYFAVTKAFRNKYFTTGSYSNDIG 121

  Fly   139 LIRLNDTIKFNEYTQPAELPTAP--VANGTQLLLTGWGSTELWGDT-PDILQKAYLTHVVYSTCQ 200
            ::|:...:|||...:|..:.|.|  |.|.......|||.||  .:| ..:|:...|..:..|.|.
  Fly   122 ILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTE--NETFSKVLKTVELNELNASECY 184

  Fly   201 EIM--NNDPSNGPCHICTLTTGGQGACHGDSGGPLTH----NG----VLYGLVNWGYPCALGVPD 255
            .::  |...|    .||.....|. .|.|||||||.|    :|    |..|::::| ......|.
  Fly   185 NMLWVNVTES----QICAGHPDGD-TCAGDSGGPLIHPVYMDGSLRYVQLGIISFG-SSLCNSPG 243

  Fly   256 SHANVYYYLEWIRSMI 271
            .:..:..:::||..::
  Fly   244 VYTRLSSFIDWILMVV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 59/205 (29%)
Tryp_SPc 50..269 CDD:238113 61/207 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 59/205 (29%)
Tryp_SPc 34..255 CDD:238113 59/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.