DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG30082

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:250 Identity:74/250 - (29%)
Similarity:111/250 - (44%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRV--------I 104
            ||::.|....:|...:...|. .....:|.|.:|.:|.|||||||::.::...:|:        |
  Fly    38 NRIVGGRTADIGSNPWLAYLH-KNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRI 101

  Fly   105 TGTVE-----YEKPDAVYFVEEHWIHCNYNS-PDYHNDIALIRLNDTIKFNEYTQPAELPTAP-- 161
            ..|.|     ||:    |.||..:||..:.. .|..|||.|::||.|:.:..:.:|..|...|  
  Fly   102 DCTSEFCIPTYEE----YSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQ 162

  Fly   162 VANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQ---G 223
            |...:.....|||..:|. :|..:||...|..:..|.|:..:....|.|  ..|    .||   .
  Fly   163 VPYSSTYEAAGWGKIDLI-NTATVLQTVNLIRLDQSDCERSLRTSLSYG--QFC----AGQWRAD 220

  Fly   224 ACHGDSGGPLTH---NG-----VLYGLVNWGYPCALGVPDSHANVYYYLEWIRSM 270
            .|.|||||||:.   ||     |..|:|::|:....| |..:..|..:..||.|:
  Fly   221 TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG-PGVYTYVPSFTNWILSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/244 (29%)
Tryp_SPc 50..269 CDD:238113 71/245 (29%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 70/244 (29%)
Tryp_SPc 40..274 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.