DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Prss38

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:251 Identity:76/251 - (30%)
Similarity:108/251 - (43%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYGG-HICGGCIIDERHVLTAAHCV-YGYNPTYLRVITGTVE 109
            |.:::.||..:..:..:|:||.  |.| |||||.|:....||:||||. .|.......:..|...
Mouse    53 QGKLLGGEFARDRKWPWQVSLH--YSGFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITN 115

  Fly   110 YEKPDAVYFVEEHW-------IHCNYNSPDYH---NDIALIRLNDTIKFNEYTQPAELPTAPVAN 164
            .||.:.    ...|       ||..:..  ||   .|:||::|...|.|:::..|..||.     
Mouse   116 LEKANR----HTQWFEIYQVIIHPTFQM--YHPIGGDVALVQLKSAIVFSDFVLPICLPP----- 169

  Fly   165 GTQLLL-------TGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHIC-----TL 217
             :.|.|       ||||.....|:|.:.|.:|.|..:....||.:........|..:|     |:
Mouse   170 -SDLYLINLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTM 233

  Fly   218 TTGGQGACHGDSGGPL----THNGVLYGLVNWGYPCALGV-PDSHANVYYYLEWIR 268
                :..|.||||.||    ....:..|:|:||..||..: |...|||.|:|.|||
Mouse   234 ----KNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWIR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/246 (29%)
Tryp_SPc 50..269 CDD:238113 75/248 (30%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 75/246 (30%)
Tryp_SPc 58..284 CDD:214473 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.