DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG43335

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:111/260 - (42%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE 111
            :.|:|.|.|.::....:...|...: .:.|.|.:|..:.|||||||:.......:|:  |.....
  Fly    39 RTRIIGGSDAEITSHPWMAYLYNEF-HYFCAGTLITNQFVLTAAHCIEASKNLTVRL--GGSGLT 100

  Fly   112 KPDAVYFVEEHWIHCNYNSPDYH----------------NDIALIRLNDTIKFNEYTQPAELPTA 160
            :.|...        |...:.||.                ||||:|||..|:||.::.:|..:...
  Fly   101 RSDGSM--------CQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILD 157

  Fly   161 P-----VANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTG 220
            |     :.:|..|:.||||..:. ...|.:||:|.:|.:..:.|.::.:...:.|  .||   .|
  Fly   158 PAVRLLLEDGMTLMATGWGLADK-RMHPHLLQEAPITVMNRNVCSKLYDVAITQG--QIC---AG 216

  Fly   221 GQ--GACHGDSGGPLTHNGVL----------YGLVNWG-YPCALGVPDSHANVYYYLEWIRSMIS 272
            .:  ..|.|||||||  .||:          ||:.::| ..|.  .|..:.::..|..||..::|
  Fly   217 DKETNTCLGDSGGPL--GGVVNYYGDLRFVQYGITSFGDIECR--SPSIYTDLSTYSGWINMVVS 277

  Fly   273  272
              Fly   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 65/251 (26%)
Tryp_SPc 50..269 CDD:238113 66/252 (26%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 65/251 (26%)
Tryp_SPc 42..275 CDD:238113 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.