DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and KLK11

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:284 Identity:79/284 - (27%)
Similarity:131/284 - (46%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PISAVRLAQLSEDQLEWISKAEG-VNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDER 84
            |:.|:|:.||.     .::.|.| |..:.|:|.|.:.:.....:|.:|... ...:||..:|..|
Human    29 PLQAMRILQLI-----LLALATGLVGGETRIIKGFECKPHSQPWQAALFEK-TRLLCGATLIAPR 87

  Fly    85 HVLTAAHCVYGY----NPTYLRVITGTVEY--------------------EKPDAVYFVEEHWIH 125
            .:||||||:..:    :||::.....:..|                    |..:......|.:.|
Human    88 WLLTAAHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPH 152

  Fly   126 CNYN----SPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGST---ELWGDTP 183
            ..:|    :.|:.|||.|:::...:......:|..|.:..|..||..|::|||||   :|  ..|
Human   153 PGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQL--RLP 215

  Fly   184 DILQKAYLTHVVYSTCQEIMNNDPSN-GPCHIC-TLTTGGQGACHGDSGGPLTHNGVLYGLVNWG 246
            ..|:.|.:|.:.:..|:   |..|.| ....:| ::..||:.:|.|||||||..|..|.|:::||
Human   216 HTLRCANITIIEHQKCE---NAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWG 277

  Fly   247 Y-PCAL-GVPDSHANVYYYLEWIR 268
            . |||: ..|..:..|..|::||:
Human   278 QDPCAITRKPGVYTKVCKYVDWIQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 69/252 (27%)
Tryp_SPc 50..269 CDD:238113 70/254 (28%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 69/252 (27%)
Tryp_SPc 54..303 CDD:238113 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.