DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG42694

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:277 Identity:56/277 - (20%)
Similarity:105/277 - (37%) Gaps:69/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIID 82
            |..|||...:.:|.:.|..|::         .:.||..|                  :|.|.:|.
  Fly    27 CGAPISNQSITKLRQPQAGWLA---------HISNGTHV------------------LCSGSLIS 64

  Fly    83 ERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHW------IHCNYNSPDYHNDIALIR 141
            ::.||:||.|:..:...::::  |.....|       ..||      :..:::......||.|::
  Fly    65 KQFVLSAAQCIDVHGKLFVQL--GVSNATK-------SPHWYTVSNVVIPSHSGKRLQRDIGLLK 120

  Fly   142 LNDTIKFNEYTQPAELPTAPVANGTQLL-----LTGWGSTELWGDTPDILQKAYLTHVVYSTCQE 201
            |:.::.:|::..|     ..:|..|..|     |..: :|..|.......|...|:.:....|: 
  Fly   121 LSQSVDYNDFVYP-----ICIALNTNTLDMVKILQNF-TTSAWLSKNKNPQTIVLSQLSRDRCK- 178

  Fly   202 IMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTH---------NGVLYGL---VNWGYPCALGVP 254
             :|...:..|..||..:.....:|..|||..||.         ..:|:|:   ||....|:  .|
  Fly   179 -LNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCS--EP 240

  Fly   255 DSHANVYYYLEWIRSMI 271
            ..:.:|...:.||.:::
  Fly   241 AIYIDVAECVGWIETVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 47/240 (20%)
Tryp_SPc 50..269 CDD:238113 49/241 (20%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 50/255 (20%)
Tryp_SPc 46..253 CDD:214473 48/252 (19%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.