DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and LOC101730924

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:241 Identity:80/241 - (33%)
Similarity:111/241 - (46%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTY--------LRVI 104
            :::|.|.........|.:||...|  |.|||.:|:.:.|::||||   |..:.        :.:.
 Frog    19 DKIIGGATCAKNSVPYIVSLNSGY--HFCGGSLINNQWVVSAAHC---YKASIQVRLGEHNIALS 78

  Fly   105 TGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLL 169
            .||.::.....|.      .|..|||....|||.||:|:.....|.......||:...|.||..|
 Frog    79 EGTEQFISSSKVI------RHSGYNSWTLDNDIMLIKLSSAASLNAAVNAVALPSGCAAAGTSCL 137

  Fly   170 LTGWGSTELWGDT-PDILQKAYLTHVVYSTCQ-----EIMNNDPSNGPCHICT-LTTGGQGACHG 227
            ::|||:|...|.. ||:||..|...:..:.|.     ||.||       .||. ...||:.:|.|
 Frog   138 ISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPGEITNN-------MICLGFLEGGKDSCQG 195

  Fly   228 DSGGPLTHNGVLYGLVNWGYPCA-LGVPDSHANVYYYLEWIRSMIS 272
            |||||:..||.|.|:|:|||.|| ...|..:..|..|..||:|.|:
 Frog   196 DSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQSTIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 76/233 (33%)
Tryp_SPc 50..269 CDD:238113 78/234 (33%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.