DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and LOC100490788

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001333500.1 Gene:LOC100490788 / 100490788 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:248 Identity:70/248 - (28%)
Similarity:121/248 - (48%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYN-PTYL 101
            ::.|..::..::::.|.:.......:|:... ..|.:.|||.:|..|.:::||||   |. |..|
 Frog    12 VAAAAPLDDDDKIVGGYECTPHSQPWQVFFT-FNGRNWCGGSLISPRWIISAAHC---YQPPKTL 72

  Fly   102 RVITGTVEYEKPDAVYFVEEH------WIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA 160
            ..:.|..:.:|.:.   .|:|      :.|..|....|.:||.|::|....::|:|.||..:..:
 Frog    73 VALLGEHDLKKKEG---TEQHIQVEAAYKHFGYKDEAYDHDIMLVKLAKPAQYNQYVQPIPVARS 134

  Fly   161 PVANGTQLLLTGWGSTELWG-DTPDILQKAYLTHVVYSTC-----QEIMNNDPSNGPCHICT-LT 218
            ...:|.:.|::|:|:...:. ..||.||...|..:..|:|     ::|..|       ..|. ..
 Frog   135 CPTDGAKCLVSGYGNLLAYNIRYPDQLQCLDLPILSDSSCKASYPRQISEN-------MFCAGFL 192

  Fly   219 TGGQGACHGDSGGPLTHNGVLYGLVNWGYPCA-LGVPDSHANVYYYLEWIRSM 270
            .|.:.:|.|||||||..:|.|||:|:||..|| ...|..:|.|..||:||:::
 Frog   193 EGEKDSCQGDSGGPLICSGELYGVVSWGRYCARKNAPGVYAKVCNYLDWIKNI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 67/232 (29%)
Tryp_SPc 50..269 CDD:238113 69/233 (30%)
LOC100490788NP_001333500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.