DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and zgc:171509

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:248 Identity:75/248 - (30%)
Similarity:113/248 - (45%) Gaps:51/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHC-----VYGYNPTYLRVITGT 107
            :::|.|.:.|.....:|..|...||  :|||.:|.|..|::||||     :.......|.|:..|
Zfish    19 DKIIGGHECQPHSQPWQARLDDGYG--LCGGSLIHESWVVSAAHCKSSSIIVHLGKHDLFVVEDT 81

  Fly   108 VEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTG 172
            .:..:.:.|.      .|..||:.:::|||.||:|.:....|...:|..|||.....|.|.|::|
Zfish    82 AQEIQAEKVI------SHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSHAGEQCLVSG 140

  Fly   173 WGSTELWGDTPD---------ILQKA--------YLTHVVYSTCQEIMNNDPSNGPCHICTLTTG 220
            ||.|   ||:..         ||.||        .:|..::  |...|:               |
Zfish   141 WGVT---GDSISSTLQCLELPILSKADCKSAYGRVITKKMF--CAGFMD---------------G 185

  Fly   221 GQGACHGDSGGPLTHNGVLYGLVNWGYPCA-LGVPDSHANVYYYLEWIRSMIS 272
            |:.:|.||||||:..||.|.|:|::|..|| .|.|..:..|..|:.||..:|:
Zfish   186 GKDSCQGDSGGPVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWINYIIA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/240 (30%)
Tryp_SPc 50..269 CDD:238113 74/241 (31%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 72/240 (30%)
Tryp_SPc 21..234 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.