DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Gm2663

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:238 Identity:74/238 - (31%)
Similarity:114/238 - (47%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NFQNRVINGEDVQLGEAKYQISL-QGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTV 108
            |..::::.|.........||:|| .|:  .|.|||.:|:::.||:||||       |.|.:...:
Mouse    19 NSDDKIVGGYTCPKHSVPYQVSLNDGI--SHQCGGSLINDQWVLSAAHC-------YKRRLQVRL 74

  Fly   109 EYEKPDAV----YFVEEHWI--HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQ 167
            .....|.:    .|::...|  |.:||.....|||.||:|......|.......||.:..:...|
Mouse    75 GEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLPRSCASTNAQ 139

  Fly   168 LLLTGWGST-ELWGDTPDILQKAYLTHVVYSTCQEIMNND-PSNGPCHICTLTTGGQGACHGDSG 230
            .|::|||:| .:.|..|.:||......:..|:|::..... .||..|  .....||:.:|.||||
Mouse   140 CLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFC--LGFLEGGKDSCDGDSG 202

  Fly   231 GPLTHNGVLYGLVNWGYPCAL-GVPDSHANVYYYLEWIRSMIS 272
            ||:..||.:.|:|:||..||: |.|..:..|..||.||:..::
Mouse   203 GPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/227 (31%)
Tryp_SPc 50..269 CDD:238113 73/228 (32%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 71/227 (31%)
Tryp_SPc 24..243 CDD:238113 73/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.