DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Prss37

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_080593.1 Gene:Prss37 / 67690 MGIID:1914940 Length:237 Species:Mus musculus


Alignment Length:216 Identity:54/216 - (25%)
Similarity:90/216 - (41%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 APYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGA--IYYTAEIH 110
            |||...|:.  ..:.|.|.::..:|::...||   ::|.|..::.........|.  ..|..:|.
Mouse    27 APYLAYLKS--NFNPCVGVLIKASWVLAPSHC---YLPNLRVMLGNFKSRVRDGTEQTIYPIQII 86

  Fly   111 KHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTG--WGSDVAYGSSMEDL 173
            ::..|......:|:.|:||.:..|||...|.:.:.|..|:.|....|:|  |..:  ......||
Mouse    87 RYWNYSHTAPQDDLMLIKLAKPATFNHKVQVLPIATTNVRPGTVCTLSGLDWSQE--NNGRHPDL 149

  Fly   174 HKLTVGLVPLD-ECYETFNRTS---SMGVGHICTFSR-EGEGACHGDSGGPLVSNGQLVGVVNWG 233
            .:.....|..| :|.:|...:|   |:.|..:..||| .||.|.     ..::...:|.| :..|
Mouse   150 RQNLEAPVMTDKDCQKTQQGSSHRNSLCVRFVKVFSRIFGEVAV-----ATVICKNKLQG-IEVG 208

  Fly   234 RPCGVGLPDVQANVYYYLDWI 254
            ...| |...:..|:|.|:.||
Mouse   209 HFMG-GDVGIYTNIYSYVPWI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 52/214 (24%)
Tryp_SPc 39..257 CDD:238113 54/216 (25%)
Prss37NP_080593.1 Tryp_SPc 28..231 CDD:389826 53/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8086
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.