DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG17234

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:281 Identity:91/281 - (32%)
Similarity:124/281 - (44%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLILLAVKPPNPCESKRIVGPFPAGQ----SGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAI 67
            |.|:|||            :....|||    ..||.|||...|...|:||||| ..|.|.|||:|
  Fly     5 SFLLLLA------------LDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSI 56

  Fly    68 LNENWIITAGHCV----------ENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHN 122
            .:||.|:||.||.          :.:.....:.:|.:|     |.:...|.:..|..|......|
  Fly    57 YSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSN-----GTLVDVAALIIHEEYAFDLNIN 116

  Fly   123 DIALVKLTENITFNELTQPIAL-PTRPVQLGEEIVLTGWG-------SDVAYGSSMED--LHKLT 177
            |||:|:|:..:.|....|||.| .|.|......:| :|||       |...|.:.::.  ||..:
  Fly   117 DIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALV-SGWGVSYILNDSTNLYPTHLQGLALHIKS 180

  Fly   178 VGLVPLDE----CYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGV 238
            :....|.:    |..|:.||                 |||||||||||.|.||||||:|||. |.
  Fly   181 IFSCRLFDPSLLCAGTYGRT-----------------ACHGDSGGPLVVNKQLVGVVSWGRK-GC 227

  Fly   239 GLPDVQANVYYYLDWIRSKLS 259
            .......:|.|:.:||.:.::
  Fly   228 VSSAFFVSVPYFREWILNAIA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 81/241 (34%)
Tryp_SPc 39..257 CDD:238113 81/241 (34%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 81/241 (34%)
Tryp_SPc 27..243 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.