DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG17239

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:222 Identity:72/222 - (32%)
Similarity:111/222 - (50%) Gaps:10/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEP 100
            ||.||:...|...|:|.|:..: |..:||.||.:|:.:|||.||:.:.....::|..|::.....
  Fly    23 RIVGGDLITILSVPWQASILRL-GRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFG 86

  Fly   101 GAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVA 165
            |.:...:.:..|..|||.: .||||:::|...:........|.|...|...|....::|||:...
  Fly    87 GQVVRVSSVLLHEEYDQSW-SNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGF 150

  Fly   166 YGSSMEDLHKLTVGLVPLDECYETFNR--TSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVG 228
            ..:....:...:|.:|..|:|..::.|  |..|    ||. :..|:.||.|||||||||..:|||
  Fly   151 KKNYPMSILSASVDIVDQDQCRRSYGRKITKDM----ICA-AAPGKDACSGDSGGPLVSGNKLVG 210

  Fly   229 VVNWGRPCG-VGLPDVQANVYYYLDWI 254
            :|::|:.|. ...|.|.|||.....||
  Fly   211 IVSFGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 70/220 (32%)
Tryp_SPc 39..257 CDD:238113 70/219 (32%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/220 (32%)
Tryp_SPc 24..237 CDD:238113 69/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.