DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG18754

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:108/262 - (41%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNEN------WIITAGHCVENFIPALVNVITGT 94
            |.:|.|.||:...|:.|.|             |.||      :::||.|||........:::..:
  Fly   105 RDRGAENAELNEYPWMVLL-------------LYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKS 156

  Fly    95 NKWAEPGAIYYTAEI---HKHCMYDQPYMH-----------NDIALVKLTENITFNELTQPIALP 145
            .:..|......|:|.   |......|..:|           |||||::|...:.:.:..|||.|.
  Fly   157 VRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLL 221

  Fly   146 TRPVQLGE-EIVLTGW----GSDVAYGSSMEDLHKLTVGLVPLDEC---YETFNRTSSMGVGHIC 202
            .....|.: .:.::||    .|.....|::::.:       |.| |   |.:|...|.:..|.  
  Fly   222 DAEFPLQDLNLQISGWDPTKSSQTLITSTVKERN-------PAD-CLNRYPSFRSASQVCAGG-- 276

  Fly   203 TFSREGEGACHGDSGGP---LVSNGQ-----LVGVVNWGRP-C-GVGLPDVQANVYYYLDWIRSK 257
              .|:|: .|.|.||.|   ::.:|.     |.|:.::|:. | ..|:|.|...:.::.:||::.
  Fly   277 --QRKGD-TCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKAN 338

  Fly   258 LS 259
            |:
  Fly   339 LA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 59/255 (23%)
Tryp_SPc 39..257 CDD:238113 60/255 (24%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/255 (24%)
Tryp_SPc 108..335 CDD:214473 58/252 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.