DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Prss53

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:324 Identity:72/324 - (22%)
Similarity:118/324 - (36%) Gaps:101/324 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCV 80
            ||.|.|...:.|.:                   |:|.|::. .|.|.|.|:::.:.|::||.||.
  Rat    35 PPEPQEGNTLPGEW-------------------PWQASVRR-QGVHICSGSLVADTWVLTAAHCF 79

  Fly    81 ENFIPALV---NVITGTNK--WAEPGAIYY-TAEIHKHCMYDQPYMHNDIALVKLTENITFNELT 139
            |....|.:   :|:.|:.|  ...|||... .|.:.....|:.....:|:||::||..|....|.
  Rat    80 EKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPIVHTTLC 144

  Fly   140 QPIALPTRPVQLGEEIVLTGWGSDVAYG---------------------------SSMED----- 172
            .|  .||.....|.....|||..:.:.|                           |.::.     
  Rat   145 LP--QPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPL 207

  Fly   173 -----LHKLTVGLVPLDECYETFNR------TSSMGVGHICTFSREG-EGACHGDSGGPLV---- 221
                 |..|.:.|:....|...:||      .:....|.:|..::.| :|.|.||||||::    
  Rat   208 PVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARSGMLCGGAQPGVQGPCQGDSGGPVMCREP 272

  Fly   222 -SNGQLVGVVNWGRPCG-----VGLPDVQANVYYYLDWIRS---------------KLSGNNKC 264
             .:...||::::...|.     |.|.|:.|    :..|:::               |:|..|.|
  Rat   273 DGHWVQVGIISFTSNCAQEDTPVLLTDMAA----HSSWLQAHVDRAAFLVQDPGVVKMSDENSC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 62/277 (22%)
Tryp_SPc 39..257 CDD:238113 63/292 (22%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 64/290 (22%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.