DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Prss36

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:262 Identity:79/262 - (30%)
Similarity:113/262 - (43%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGT---- 94
            |.||.||.:|..|..|:||||.. .|.|.|||:::..:|:::|.||.         |..||    
  Rat    56 SSRIVGGSDAHPGTWPWQVSLHH-GGGHICGGSLIAPSWVLSAAHCF---------VTNGTLEPA 110

  Fly    95 NKWA------------EPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTR 147
            ::|:            |...:...|.|.....|.:..:..|:||::|..........:|:.|| |
  Rat   111 DEWSVLLGVHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLP-R 174

  Fly   148 PVQL---GEEIVLTGWGSDVAYGSSME---DLHKLTVGLVPLDEC---YE---TFNRTSSMGVGH 200
            ...|   |.....|||| ||.....:.   .|.::.:.|:....|   |.   .||.|..:..|.
  Rat   175 ASHLFAHGTACWATGWG-DVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGM 238

  Fly   201 ICTFSREG-EGACHGDSGGPLV--SNGQ--LVGVVNWGRPCG-VGLPDVQANVYYYLDWIRSKLS 259
            :|....|| ...|.||||||||  ..|:  |.|:.::|..|| ...|.|...|.:|..|||..:.
  Rat   239 LCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWIREHVM 303

  Fly   260 GN 261
            |:
  Rat   304 GS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 74/251 (29%)
Tryp_SPc 39..257 CDD:238113 75/251 (30%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 76/253 (30%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.