DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:273 Identity:89/273 - (32%)
Similarity:132/273 - (48%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKL-LRLSLLILLAVKPPNPCESKRIVGPFPAGQ---SGRIKGGEEAEIGFAPYQVSLQPIVGSH 61
            ||| :.|:|.:..|...|.| |.|.:  |.|...   .|||..|..|..|..||.|.|. ..|:.
  Fly     1 MKLFVFLALAVAAATAIPTP-EQKLV--PTPVKDVKIQGRITNGYPAYEGKVPYIVGLL-FSGNG 61

  Fly    62 N--CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYY--TAEIHKHCMYDQPYMHN 122
            |  |||:|:...|::||.||........:|.  |.:...:|...::  :....:|..|:...:||
  Fly    62 NWWCGGSIIGNTWVLTAAHCTNGASGVTINY--GASLRNQPQYTHWVGSGNFVQHHHYNSGNLHN 124

  Fly   123 DIALVKLTENITFNELTQPIALPTRPVQ----LGEEIVLTGWGSDVAY-GSSMED-LHKLTVGLV 181
            ||:|:: |.::.|..|...:.||:...:    .|...|.:|||.  .| ||.:.| |..:.|.::
  Fly   125 DISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGG--TYDGSPLPDWLQAVDVQIM 186

  Fly   182 PLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSN--GQLVGVVNW--GRPCGVGLPD 242
            ...:|    :|:.|:....||..:..|:..|.||||||||::  .:||||.::  ...|..|.|.
  Fly   187 SQSDC----SRSWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPA 247

  Fly   243 VQANVYYYLDWIR 255
            |.:.|..||||||
  Fly   248 VFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 73/231 (32%)
Tryp_SPc 39..257 CDD:238113 74/231 (32%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 73/231 (32%)
Tryp_SPc 38..262 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.