DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG9737

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:271 Identity:83/271 - (30%)
Similarity:120/271 - (44%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVE----NFIPALVNVITGT 94
            :.||.|||.||:...|:...|......:.|.||::::..|:||.|||:    .....|.:|..|.
  Fly   147 TNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGE 211

  Fly    95 -NKWAEPGAI----YYTA----------EIHKHCMYDQ--PYMHNDIALVKLTENITFNELTQPI 142
             |...||..|    |.:.          :||.|..|.:  .|.:||||:::|...::|.....||
  Fly   212 FNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPI 276

  Fly   143 ALPTR--PVQL--GEEIVLTGWGSDVAYGSSMEDLH-----KLTVGLVPLDEC---YETFNRTSS 195
            .||.:  |:.|  |:...::|||....:.....::|     ||.:..|..:.|   .|.|.  ..
  Fly   277 CLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFG--VR 339

  Fly   196 MGVGHICTFSREGEGACHGDSGGPLV------SNGQLVGVVNWG-RPCGV-GLPDVQANVYYYLD 252
            :|...||......:..|.|||||||:      |.....|||::| ..||: |.|.|..||..|.|
  Fly   340 LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTD 404

  Fly   253 WIRSKLSGNNK 263
            ||.|.:....|
  Fly   405 WIDSVVQQRKK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 79/258 (31%)
Tryp_SPc 39..257 CDD:238113 79/258 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 79/258 (31%)
Tryp_SPc 150..409 CDD:238113 80/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.