DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:297 Identity:79/297 - (26%)
Similarity:128/297 - (43%) Gaps:59/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLL-ILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHN-- 62
            :.||.|:.| :..|:..|:.....|.:.....|..|||..|..|..|..||.|.:.  :.|:.  
  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVS--LNSNGNW 66

  Fly    63 --CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQP------- 118
              |||:|:...|::||.||...               |:..::||.|     ..|::|       
  Fly    67 WWCGGSIIGHTWVLTAAHCTAG---------------ADEASLYYGA-----VNYNEPAFRHTVS 111

  Fly   119 ------YMH-----NDIALVKLTENITFNELTQPIALPTRPVQLGEE----IVLTGWGSDVAYGS 168
                  |.|     :|:||:| |.::.|..|...|.||:...:....    :...|||:.....:
  Fly   112 SENFIRYPHYVGLDHDLALIK-TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSN 175

  Fly   169 SMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVS--NGQLVGVVN 231
            .:|||..:.:.::.:.|| :.:..|.:.....||..:.:|:..|.||||||||:  ..:|:|:.:
  Fly   176 VVEDLRVVDLKVISVAEC-QAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITS 239

  Fly   232 W--GRPCGVGLPDVQANVYYYLDWIRSKLSGNNKCYY 266
            :  ...|.||.|.....|..||:||:.:..    .||
  Fly   240 FVSAYGCQVGGPAGFTRVTKYLEWIKEETG----IYY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 66/247 (27%)
Tryp_SPc 39..257 CDD:238113 66/247 (27%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 66/247 (27%)
Tryp_SPc 41..266 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.