DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG11843

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:335 Identity:90/335 - (26%)
Similarity:129/335 - (38%) Gaps:97/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRL--SLLILLAVKPPNPCESKRIVGPFP----AGQSGRIKGG---EEAEIGFAPYQVSLQP 56
            ||:.||  .|::.||      |    :.|..|    .|...|.|..   |..|.||.....|::.
  Fly     1 MKIWRLFSQLIVSLA------C----VFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIES 55

  Fly    57 ------------IVGSHN-------------------------CGGAILNENWIITAGHCVENFI 84
                        |||.|.                         |||.:::|.:::||.||:|: .
  Fly    56 RIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLES-E 119

  Fly    85 PALVNVI-------TGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPI 142
            ...|||:       ...::.|.| ..|..|....|..|:.|..::||.||||||.:.|:....|.
  Fly   120 RGEVNVVRLGELDFDSLDEDAAP-RDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPA 183

  Fly   143 ALPTRPVQLGEEIVLTGWGSD---------------VAYGSSMEDLHKLTVGLVPLDECYETFNR 192
            .||.:..:..:..:..||||.               ..||:.:  ..||      |....|.|.|
  Fly   184 CLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWV--CKKL------LTRQVEEFPR 240

  Fly   193 TSSMGVGHICTFSREGEGACHGDSGGPLVSNGQ-------LVGVVNWGRPCG-VGLPDVQANVYY 249
            ... |...:|..|...:..|:|||||||:...:       :||:.:.|..|| .|:|.:...||.
  Fly   241 GFD-GNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYP 304

  Fly   250 YLDWIRSKLS 259
            ||.||...|:
  Fly   305 YLGWIARTLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 76/287 (26%)
Tryp_SPc 39..257 CDD:238113 76/287 (26%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 71/254 (28%)
Tryp_SPc 68..309 CDD:214473 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.