DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG11842

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:230 Identity:63/230 - (27%)
Similarity:108/230 - (46%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGAILNENWIITAGHCVENFIP-ALVNV-------ITGTNKWAEPGAIYYTAEIHKHCMYDQPY 119
            |||.::::..::||.||  ::.| ..||:       ....|..|:| ..:...:...|..:..|.
  Fly   103 CGGTLISDRHVLTAAHC--HYSPQGSVNIARLGDLEFDTNNDDADP-EDFDVKDFTAHPEFSYPA 164

  Fly   120 MHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGS-DVAYGSSMEDLHKLTVGLVPL 183
            ::|||::|:|:..:|||:...|..||....:||...:..|||. ::...:..:.|.|     |.|
  Fly   165 IYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQK-----VKL 224

  Fly   184 --------------DECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV-------SNGQLV 227
                          ||..|.:|.|:.:.:|     |.|.:..|:||||||::       ....::
  Fly   225 YNYGTRCRITADRNDELPEGYNATTQLCIG-----SNEHKDTCNGDSGGPVLIYHMDYPCMYHVM 284

  Fly   228 GVVNWGRPCGV-GLPDVQANVYYYLDWIRSKLSGN 261
            |:.:.|..|.. .||.:...|::|||||:.:|:.|
  Fly   285 GITSIGVACDTPDLPAMYTRVHFYLDWIKQQLAKN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 59/221 (27%)
Tryp_SPc 39..257 CDD:238113 61/224 (27%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 61/224 (27%)
Tryp_SPc 73..312 CDD:214473 59/221 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.