DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG16710

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:287 Identity:75/287 - (26%)
Similarity:117/287 - (40%) Gaps:65/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PNPCESKRIVGP-FPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSH------------NCGGAIL 68
            ||    .:|.|| .||   .||.||||.:....|:   :..|:.:|            .|.|:::
  Fly    92 PN----TQICGPIMPA---YRIFGGEETQPNELPW---MALILYAHRSRSVWNERLVSRCAGSLI 146

  Fly    69 NENWIITAGHCV--------------ENFI--PALVNVITGTNKWAEPGAIYYTAEI---HKHCM 114
            ...:::||.||:              .|.:  |..|..|.|....| |..:....::   |:|.|
  Fly   147 TNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCA-PEHLEIDVDLSIKHRHYM 210

  Fly   115 YDQPYMHNDIALVKLTENITFNELTQPIALP-----TRPVQLGEEIVLTGWGSDVAYGSSMEDLH 174
            ..:...:|||||::|...:.:....:||.:.     :.|.....::.:.|||.....|.|...|.
  Fly   211 VFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQ 275

  Fly   175 KLTVGLVPLDECYETFNRTSSMGVG---HICTFSREGEGACHGDSGGPLVS---NGQ-----LVG 228
            ....|. ..|||..:   ..|:|:.   |||..:..|...|.|||||||::   .|.     |.|
  Fly   276 AYVNGR-NADECSLS---EPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAG 336

  Fly   229 VVNWG-RPCGVGLPDVQANVYYYLDWI 254
            :.::| ..||.| |........:::||
  Fly   337 ITSYGYSQCGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 66/265 (25%)
Tryp_SPc 39..257 CDD:238113 66/264 (25%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 66/265 (25%)
Tryp_SPc 106..362 CDD:238113 65/264 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.