DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG31199

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:218 Identity:41/218 - (18%)
Similarity:68/218 - (31%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VGSHNCGGAILNENWIITAGHCVENF-----------------IPALVNVITGTNKWAEPGAIYY 105
            :..:.|.|.::::..::...||...:                 .|..|.|.........|.....
  Fly    66 IRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIK 130

  Fly   106 TAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIV-------------- 156
            .|||..|..||...:.|.:|::.|..:........||.:|. |..|.|.:|              
  Fly   131 LAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPP-PSLLNETLVAQTFVVAGLRVFED 194

  Fly   157 --LTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGP 219
              |..|.:.::.|.....:..|.               |||   ..:|.:.::.....   .|.|
  Fly   195 FRLKTWVNTLSRGFCQSKVKTLV---------------TSS---NTVCGYHKQPVAYY---LGAP 238

  Fly   220 LV---------SNGQLVGV-VNW 232
            ||         .|..|||: ::|
  Fly   239 LVGLQKKGHVTQNYYLVGIMIDW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 41/218 (19%)
Tryp_SPc 39..257 CDD:238113 41/218 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 39/212 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.