DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG10405

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:263 Identity:82/263 - (31%)
Similarity:120/263 - (45%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLRLSLLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSL--QPIVGSHNCGG 65
            ||...:|::|        |:.|.....|.....||..|.||..|..|||:||  |.:   |.||.
  Fly    11 LLIAGILVIL--------EASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTV---HICGA 64

  Fly    66 AILNENWIITAGHCVENF--IPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVK 128
            :||:.||.|||.||::..  .|....:..|:......|.:.....|:||..||:..|:.|:||::
  Fly    65 SILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLR 129

  Fly   129 LTENITFNEL--TQPIALPTRPVQLGEEI------VLTGWG----SDVAYGSSMEDLHKLTVGLV 181
            ..:......|  ..||.|||    :||.|      |::|||    |:....|.::....|||.  
  Fly   130 TADGALSLPLGKVAPIRLPT----VGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVN-- 188

  Fly   182 PLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGVGLPDVQAN 246
             .::|:........:.....|..:|..: ||.||||||:.:.|.|:|:|:||..|        |:
  Fly   189 -QEKCHNDLRHHGGVTEAMFCAAARNTD-ACQGDSGGPISAQGTLIGIVSWGVGC--------AD 243

  Fly   247 VYY 249
            .||
  Fly   244 PYY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 75/230 (33%)
Tryp_SPc 39..257 CDD:238113 73/227 (32%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 75/230 (33%)
Tryp_SPc 37..263 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.