DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and snk

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:244 Identity:69/244 - (28%)
Similarity:109/244 - (44%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IKGGEEAEIGFAPYQVSLQPIVGSHN--------CGGAILNENWIITAGHCVENFI--PALVNVI 91
            |.||.....|..|:..:|....||.:        ||||:::|.:::||.||..:..  |.:|.: 
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRL- 249

  Fly    92 TGTNKWAEPGAIYYTAE---IHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGE 153
             |..:..|..|.....:   |..|..|.....::||||:|||..:.|:|..:|..|...|.....
  Fly   250 -GARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIP 313

  Fly   154 EIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSM--GV--GHICT-FSREGEGACH 213
            .:|..|||.....|:....|.::.:.:||...|.:.:.:...:  |:  |..|. :...|...|.
  Fly   314 TVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQ 378

  Fly   214 GDSGGPLVS-------NGQLVGVVNWGRPCGV-GLPDVQANVYYYLDWI 254
            ||||||:.:       ...:||:.::|:.|.. ..|.|...:|.|||||
  Fly   379 GDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 67/242 (28%)
Tryp_SPc 39..257 CDD:238113 68/242 (28%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 69/244 (28%)
Tryp_SPc 186..427 CDD:214473 67/242 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.