DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG13318

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:254 Identity:74/254 - (29%)
Similarity:113/254 - (44%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVIT 92
            |.|.|.:....|  :|..|..|:|.:|......:..|||::....::||.|.|.|.......|..
  Fly   156 PPPPGSTTAAPG--QASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRL 218

  Fly    93 GTNKWAE-------PGAIYYTAEIHKHCMYDQPYMHNDIALVKLTE--NITFNELTQPIALPTRP 148
            |  :|..       |....|.:.::.:..::...:.||:|::||:.  ::|.......:.|||..
  Fly   219 G--EWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTS 281

  Fly   149 VQLGEEIVLTGWGSD--VAYGSSMEDLHKLTVGLVPLDECYETFNRT---SSM---GVGHICTFS 205
            . :|:...:.|||.:  .|.|:......::.|.|:|...|......|   ||.   ....||...
  Fly   282 F-VGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGG 345

  Fly   206 REGEGACHGDSGGPLV--SNG--QLVGVVNWGRPCG-VGLPDVQANVYYYLDWIRSKLS 259
            ..|:.||.||.|.|||  |||  .:||:|.||..|. .|:|.|..||..||.||::.|:
  Fly   346 EAGKDACTGDGGSPLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTLT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 68/239 (28%)
Tryp_SPc 39..257 CDD:238113 70/239 (29%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 69/235 (29%)
Tryp_SPc 169..399 CDD:214473 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.