DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and MP1

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:307 Identity:91/307 - (29%)
Similarity:138/307 - (44%) Gaps:80/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PNPCESKRIVGPFPAGQSG----------------RIKGGEEAEIGFAPYQVSLQPI----VGSH 61
            |.|.::.:     |..:||                |:.||.|......|:...::..    |..|
  Fly   107 PQPTQTTK-----PTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGH 166

  Fly    62 NCGGAILNENWIITAGHCVENFIPA---LVNVITGTNKW------------------AEPGAIYY 105
            :|||:::|..:::||.||| :.||:   |..|..|  :|                  .||...|.
  Fly   167 HCGGSLINHRYVLTAAHCV-SAIPSDWELTGVRLG--EWDASTNPDCTVGKNGRRDCNEPYVDYP 228

  Fly   106 TAEIHKHCMY-----DQPYMHNDIALVKLTENITFNELTQPIALPTRPVQ-----LGEEIVLTGW 160
            ..|...|..|     ||   .|||||::|.:.:.:::...|:.|||...|     ||.::|:.||
  Fly   229 VEERIPHPQYPGNSRDQ---LNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGW 290

  Fly   161 G-SDVAYGSSMEDLHKLTVGLVPLDEC---YETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV 221
            | ::..:.|:::  .|..:..||..||   |.|..||  :....:|....||..:|.|||||||:
  Fly   291 GRTETNFTSNIK--LKAELDTVPTSECNQRYATQRRT--VTTKQMCAGGVEGVDSCRGDSGGPLL 351

  Fly   222 ----SNGQ----LVGVVNWG-RPCGV-GLPDVQANVYYYLDWIRSKL 258
                |||.    :.|||::| .|||: |.|.|...|..||:||.:.:
  Fly   352 LEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 84/266 (32%)
Tryp_SPc 39..257 CDD:238113 85/266 (32%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 84/266 (32%)
Tryp_SPc 138..397 CDD:238113 85/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.