DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG18180

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:123/276 - (44%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCG- 64
            |||..|:|...||:...:|....|.. ....|..|||..|..|..|.|||.|.|.......|.| 
  Fly     1 MKLFLLTLSAALALVAASPTGLNRTT-LLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64

  Fly    65 ---GAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHN---- 122
               |.|:..:||:||.||:..   ..|.:..|:| |...||  |...:.:......|...:    
  Fly    65 VGAGTIIANDWILTAAHCLTG---DYVEIHYGSN-WGWNGA--YRQTVRRDNFISHPDWPSQGGR 123

  Fly   123 DIALVKLTENITFNELTQPIALPTRPVQLGEE--------IVLTGWGSDVAYGSSMEDLHKLTVG 179
            ||.|:: |.::.||.|...|.||:    :.|:        .|..|||. :..|:..:.|..:.|.
  Fly   124 DIGLIR-TPHVDFNGLINKIPLPS----MNEQNDRYQDTWCVACGWGG-MDNGNLADWLQCVDVQ 182

  Fly   180 LVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVS--NGQLVGVVNWGR-PCGVGLP 241
            ::...||.:.:...:|.   .:||...:|:..|.||||||||:  |.:||||:.:.. .|..| |
  Fly   183 IISNSECEQAYGSVAST---DMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVSCHDG-P 243

  Fly   242 DVQANVYYYLDWIRSK 257
            .....|..||:|||.:
  Fly   244 SGYTRVSDYLEWIRDQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/236 (31%)
Tryp_SPc 39..257 CDD:238113 73/236 (31%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/236 (31%)
Tryp_SPc 36..259 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.