DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG8329

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:271 Identity:81/271 - (29%)
Similarity:126/271 - (46%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENW 72
            :|:||.|.......::........|....|..|..|..|.|||.|.|:...|:.. ||:::..||
  Fly     6 VLLLLFVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVG-GGSVIGNNW 69

  Fly    73 IITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHN----DIALVKLTENI 133
            ::||.||:..   ..|.:..|:|: |..|.:.:|  ::|:..:..|...|    ||.|:: |..:
  Fly    70 VLTAAHCLTT---DSVTIHYGSNR-AWNGQLQHT--VNKNNFFRHPGYPNSAGHDIGLIR-TPYV 127

  Fly   134 TFNELTQPIALPTRPVQLGEEI-----VLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRT 193
            :|..|...::|| :..|.||..     |..|||. :|.|...:.|..:.|.::...||..::...
  Fly   128 SFTNLINKVSLP-KFSQKGERFENWWCVACGWGG-MANGGLADWLQCMDVQVISNGECARSYGSV 190

  Fly   194 SSMGVGHICTFSREGEGACHGDSGGPLVS--NGQLVGVVNWGR-PCGVGLPDVQANVYYYLDWIR 255
            :|.   .:||.:.:|:..|.|||||.||:  |...|||:.:.. .|..| |.....|..:|||||
  Fly   191 AST---DMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSG-PSGYTRVSDHLDWIR 251

  Fly   256 SKLSGNNKCYY 266
            .|   :...||
  Fly   252 EK---SGIAYY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 70/229 (31%)
Tryp_SPc 39..257 CDD:238113 72/229 (31%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 73/231 (32%)
Tryp_SPc 35..250 CDD:214473 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.