DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:117/262 - (44%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITA 76
            ||.:...|..:|        ...|||..|..||.|.|||.|.| ...|...|||:|:..:|::||
  Fly    23 LATEKLTPVHTK--------DMQGRITNGYPAEEGKAPYTVGL-GFSGGWWCGGSIIAHDWVLTA 78

  Fly    77 GHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQ--------PYMHNDIALVKLTENI 133
            .||:.:               |:...:|:.|....:..:..        .:...||||::: .::
  Fly    79 EHCIGD---------------ADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHV 127

  Fly   134 TFNELTQPIALPTRPVQLGEE----IVLTGWGSDVAY-GSSMED-LHKLTVGLVPLDECYETFNR 192
            .|..:...:.||:...:..:.    .|..|||.  .| ||.:.| |..:.:.::...||...:  
  Fly   128 DFWHMVNKVELPSYNDRYNDYNEWWAVACGWGG--TYDGSPLPDYLQCVDLQIIHNSECSGYY-- 188

  Fly   193 TSSMGVGHICTFSREGEGACHGDSGGPLVSNG--QLVGVVNWG--RPCGVGLPDVQANVYYYLDW 253
             .|:|...:|..:.:|:..|.||||||||::.  :||||.|:|  ..|..|.|.....|.|:|||
  Fly   189 -GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDW 252

  Fly   254 IR 255
            ||
  Fly   253 IR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 68/235 (29%)
Tryp_SPc 39..257 CDD:238113 69/235 (29%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/235 (29%)
Tryp_SPc 40..256 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.