DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG33465

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:85/255 - (33%) Gaps:98/255 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCM 114
            ::|||.    .:...|.::...:::|......| ||.::.|.|   |:.:.   :....||.|..
  Fly   293 WEVSLH----QNTFSGVLITNRFVLTVASAFPN-IPLVMKVET---KYLKS---FDVESIHTHPR 346

  Fly   115 YDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVG 179
            :....|.|:|||:||..::..::|.:||.:...|                       .|.::...
  Fly   347 FTHSSMDNNIALLKLAHDVPNSDLVKPICIVPSP-----------------------KLPRMLTT 388

  Fly   180 LVPLDECYETFNRTSSM---GVGHICTFSREGEGACHGDSGGPLVSN---------------GQL 226
            ||  ||....|....::   .:.||         .|....|.||.||               |.:
  Fly   389 LV--DETTNDFRGVRNVTLNAINHI---------ECARRIGKPLKSNQFCVAQPIDFKVQAPGSI 442

  Fly   227 VGVVNWGRPCGVGLPDVQANVYY--------------------YLDWIRSKLSGNNKCYY 266
            :|..   |..|.|      |.||                    |||||..|:      ||
  Fly   443 IGTY---RNIGDG------NRYYLFGLMSYSKDGMVVYTYIQSYLDWIMDKV------YY 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 50/241 (21%)
Tryp_SPc 39..257 CDD:238113 52/244 (21%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113
Tryp_SPc 46..261 CDD:214473
Tryp_SPc 293..484 CDD:304450 52/244 (21%)
Tryp_SPc 293..481 CDD:214473 50/241 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.